PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 372aa    MW: 41144.9 Da    PI: 5.0274
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036660genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT++Ed +++  v+++G+g+W++++++ g++R++k+c++rw++yl
      Lus10036660 15 RGLWTPDEDAKILAHVAKYGTGNWTSVPKKAGLRRCGKSCRLRWNNYL 62
                     788********************************************7 PP

2Myb_DNA-binding44.34.2e-1470111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       + +eE+e +v+++   G++ W+ Ia+ ++ gRt++++k++w++
      Lus10036660  70 TFKPEEEEMIVRLHSAIGSR-WSIIAQQLP-GRTDNDVKNHWNT 111
                      5889****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-24765IPR009057Homeodomain-like
PROSITE profilePS5129427.2991066IPR017930Myb domain
SuperFamilySSF466899.73E-3012109IPR009057Homeodomain-like
SMARTSM007176.0E-151464IPR001005SANT/Myb domain
PfamPF002498.8E-171562IPR001005SANT/Myb domain
CDDcd001671.80E-121862No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2266117IPR009057Homeodomain-like
PROSITE profilePS5129418.03367117IPR017930Myb domain
SMARTSM007171.9E-1267115IPR001005SANT/Myb domain
CDDcd001672.43E-970113No hitNo description
PfamPF002492.7E-1270111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MVRPPACCGN VNLKRGLWTP DEDAKILAHV AKYGTGNWTS VPKKAGLRRC GKSCRLRWNN  60
YLRPDLNHET FKPEEEEMIV RLHSAIGSRW SIIAQQLPGR TDNDVKNHWN TKLRKKLSEM  120
GIDPVTHKPF SQILTDYGNI NGGLSRSPPP TRIGSLSRDL KNATTTTTTT TTTVFVHNPL  180
PQSSVNFMES ESESEIMLPI SESFTIDTDN VKEEQSMDLL EQLQAIKLVT EAANRGDETV  240
TPPVASGNPS CCSSSSSTCS TTAAQEMTMM TMKSSPPAFS WRDFLLEDND DLDQLLPDGN  300
DDDPIIGRDQ LWSSGEKQRP PRQQQNCYGA AESNANGGPT ASSSFVDAIL DGDRRRDMFL  360
DFSSLLQDPN Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321544.11e-112hypothetical protein POPTR_0015s07900g
RefseqXP_010663429.11e-112PREDICTED: myb-related protein 315 isoform X2
TrEMBLB9IEI51e-112B9IEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.18e-67MYB family protein